sweaty




FC2IPXAWDSQTEMIDVPREDSSISWAAAHMNMEYDMARAAUKSVENXCESDMILKNACXAUKGWANZPPPDRBDAPOD

2020-11-30
29 min

FC2PPV 1589767 * 1800pt → 900pt [Married woman NTR] I lent money to my dad friend who lives in the neighborhood, but he didn’t return it, so I NTR my wife aiming for the absence of my dad friend.

  • amateur uncensoredfc2
    • 2020-11-30
    59 min

    [mntj-038]ねね

  • amateur censoredbig titsamateurmntjmntj-038mntj038mntj-038
    • 2020-12-01
    56 min

    DIZ-009 Kana

  • amateur censoredcreampieamateurdizdiz-009diz009diz-009
    • 2020-12-12
    120 min

    [EBOD-789]J-Cup Extra Thick Delivery Super Aggressive Type Slutty Girl Hunts Men With Extremely Slutty Outfits Chitose Yuki

  • chitose in the evening censoredcreampieslutEBODe bodyichigoharaEBOD-789EBOD789ebod00789
    • 2020-12-20
    87 min

    [SPZ-1087]I Never Thought She'd Fuck Me! My MILF Landlady

  • censoredamateurmature womanSPZstar paradisestar paradiesSPZ-1087SPZ1087h-254spz01087
    • 2020-12-22
    49 min

    FC2PPV 1590481 [Personal shooting] Innocent and lascivious beautiful breasts Glamorous young wife Serina-san has a large amount of raw vaginal cum shot!

  • amateur uncensoredfc2
    • 2021-01-04
    87 min

    [sd-010]はるかちゃん

  • amateur censoreduniformamateursdsd-010sd010sd-010
    • 2021-01-06
    481 min

    [YVG-024]21 Girls Get Horny For Real While Showing Off Their Panties And Cum Like Crazy! All-POV Underwear Masturbation Challenge!

  • censoredslutYVGglory questYVG-024YVG02413yvg00024
    • 2021-01-13
    52 min

    FC2PPV 1643383 30 of newborn babies born in Japan are brood parasites] Former Race Queen model married woman 29 years old, a wife who is seeded in 40 minutes away from her husband! A nasty housewife who is delighted to be acme by being vaginal cum sh

  • amateur uncensoredfc2
    • 2021-01-16
    150 min

    [EKDV-653]Oiled Up Colossal Tits - Slick J-Cup Spread Wide With Ecstasy! Hana Himesaki

  • himesaki hana censoredcreampiebig titsEKDVcrystal eizokumataro morinoe kissEKDV-653EKDV65349ekdv00653
    • 2021-01-16
    160 min

    [JJBK-039]Mature Woman Babes Only A Mature Woman Came To My Room So We Took Her Home For A Peeping Good Time And Then We Sold The Footage As An Adult Video 37 Horny Mature Woman Babes Who Use Their Tall Bodies And Beautiful Colossal Tits To Fuck Male

  • censoredmature womanslutJJBKjukujo bank emmanuellemanji groupJJBK-039JJBK039jjbk00039
    • 2021-01-20
    59 min

    [srtd-192]りょう(26)

  • amateur censoredbig titsamateursrtdsrtd-192srtd192srtd-192
    • 2021-01-24
    138 min

    [ANZD-059]Amateur Wives' First Time On Camera! Her Marriage Has Been Sexless For Three Years And She's So Horny A Touch Would Make Her Cum - Cock-Crazed Married Slut Aira Sonokawa

  • aira sonokawa censoredcreampiebig titsANZDanzu daydream vacationanzuANZD-059ANZD059anzd00059
    • 2021-01-29
    64 min

    FC2PPV 1664296 [Uncensored] Dating transcendental beauty horny beauty member with chestnut stimulation Oma ● Ko juice dripping raw squirrel cum shot copulation !!: Reina (25 years old)

  • amateur uncensoredfc2
    • 2021-02-06
    118 min

    [ADN-291]Sweaty Fucking All Over In The Daytime With A Sexually Frustrated Married Woman. Iroha Natsume

  • natsume saiharu censoredsingle workdramaADNattackersnaotootona no dramaADN-291ADN291adn00291
    • 2021-02-12
    110 min

    [XRW-977]Influenced To Do A Babymaking Creampie - Sara Kakami

  • kagami sara censoredcreampiecosplayXRWreal worksreal real worksXRW-977XRW977172xrw00977
    • 2021-02-13
    76 min

    200GANA-2435 Seriously Nampa, first shot. 1597 Succeeded in picking up a female college student with a plump body who is worried about big ass! Take me to the hotel to help with body makeup and start touching on the training equipment ♪ Good quality

  • amateur censoredbig titsamateurganagana-2435gana2435200gana-2435
    • 2021-02-19
    70 min

    [KYUN-008][Delivery Only] #Loveydovey 008/Ami/22 Years Old/OL

  • censoredcreampiesquirtingKYUNprestigekyunKYUN-008KYUN008118kyun00008
    • 2021-03-01
    65 min

    492MERC-236 Nice BBQ swap

  • amateur censoreduniformschoolgirlmercmerc-236merc236492merc-236
    • 2021-03-05
    40 min

    [BTH-125]A Cherry Boy Fan Thanksgiving Day Airi Natsume

  • natsume atago censoredblowjobbeautiful girlBTHchobitchsuper bitchBTH-125BTH125h-1435bth00125
    • 2021-03-12
    36 min

    359TYVM-138 G Cup Beautiful Big Tits Young Wife Pleasure Covetous Rich Creampie Sex! !!

  • amateur censoredcreampiebig titstyvmtyvm-138tyvm138359tyvm-138
    • 2021-03-18
    49 min

    285ENDX-333 SEX with Others That Makes You Feel More Comfortable Than SEX Of A Solitary Boyfriend Is Good! A female college student with a nice ass!

  • amateur censoredcreampiebig titsendxendx-333endx333285endx-333
    • 2021-03-19
    67 min

    [sika-059]通野ちゃん(27)

  • amateur censoredcreampieamateursikasika-059sika059sika-059
    • 2021-03-20
    45 min

    FC2PPV 1735003 Youtuber full power Manki ◯ -san collaboration project, the second 3P project of those two beautiful women individual shooting, individual shooting completely original 82nd person, vaginal cum shot

  • amateur uncensoredfc2
    • 2021-04-09
    115 min

    [PARATHD-3151]10 Hot And Steamy Lesbian Videos! Beautiful Girls Learning The Pleasure Of Having Their Pussies Touched By Women

  • censoredamateurlesbianPARATHDparadise tvPARATHD-3151PARATHD3151parathd03151
    • 2021-04-14
    149 min

    [SSIS-037]Do You Want Yua Mikami To Tease You？ You Do, Don't You？

  • yua mikami censoredbig titsslutSSISs1 no 1 stylemon cSSIS-037SSIS037ssis00037
    • 2021-04-22
    93 min

    [OKP-082]Smoking Hot Office Girl In Glasses - Runa Tsukino - She Makes Suits Look Incredible With Her Beautiful Legs Encased In Pantyhose Right Down To The Tips Of Her Toes! She'll Sit On Your Face, Give You A Handjob, Or Get Showered In Bukkake

  • tsukino luna censoredsingle workbukkakeOKPdaddy s private photosgoro koenjigodly pantyhoseOKP-082OKP0821okp00082
    • 2021-04-27
    179 min

    [MDVHJ-031]I Can't Tell Anyone... Who Could Have Imagined That I Was Being Fucked By My Daughter's Husband... 4

  • censoredbig titsmature womanMDVHJgraffiti japanmovieMDVHJ-031MDVHJ03148mdvhj00031
    • 2021-05-01
    160 min

    [DVDMS-662]Smoking Hot Airport Security Guard Yuiko (Age 23) Makes Her Porn Debut - And Loses Her Virginity On Camera! A Working Girl's Porn Performance - This Slender, Toned Babe Has Defined Abs - 307 Days Of Passionate SEX

  • censoredamateurDVDMSdeep shikaru kamegashiraDVDMS-662DVDMS662dvdms00662
    • 2021-05-07
    125 min

    [GUN-752]I Want To Lick The Bottom Of Beautiful Women's Feet Until They're Soaked! IV Swimsuit Girl Version

  • kasagi ichika aya mamiya censoredbukkakeGUNradixmg yukkybatsugunGUN-752GUN752433gun00752
    • 2021-05-07
    120 min

    [FSDSS-216]Erotic Voice And Sweat: Extreme Dirty Talk Beauty Salon - Sora Amakawa

  • tenkawa sora censoredbig titssingle workFSDSSfalenozampafaleno starFSDSS-216FSDSS2161fsdss00216
    • 2021-05-07
    123 min

    [IPX-665]I Hate My Boss' Guts, But Now We're On A Business Trip Together, And To My Shock And Horror, We've Been Booked Into The Same Room At The Hot Spring Resort Inn ... This Ugly And Disgusting Horny Old Man Made Me Cum Over And Over A

  • airi kijima censoredcreampiesingle workIPXidea pocketdishIPX-665IPX665ipx00665
    • 2021-05-08
    52 min

    C0930 hitozuma1355 Mio Taira 26years old

  • amateur uncensoredc0930
    • 2021-05-08
    122 min

    [XRL-005]Disciplining A Beautiful Young Wife With Debt Problems With Dirty Talk Himari Kinoshita

  • himari kinoshita himari hanazawa censoredblowjobsingle workXRLreal worksreal real worksXRL-005XRL005xrl00005
    • 2021-05-14
    38 min

    285ENDX-345 A Female College Student Who Proved The Theory That Science Girls Like SEX! I love feeling good!

  • amateur censoredcreampiebig titsendxendx-345endx345285endx-345
    • 2021-05-20
    253 min

    [PIYO-116]Chicks Visit Your House! These Bitches Will Take Care Of You With Their Shaved Pussies.

  • ichika matsumoto lara kudo censoredPIYOchickclown fieldPIYO-116PIYO1161piyo00116
    • 2021-05-21

    FC2PPV 1830248 Weekend Limited [Uncensored] Creampie at a busty apparel clerk and an internet cafe

  • amateur uncensoredfc2
    • 2021-05-27
    64 min

    413INST-125 [Active plump model] Megumi JD2 turned into a meat urinal Outflow Gonzo with entertainment P Gonzo grows with sperm smell OK pussy convulsions metamorphosis real acme video

  • amateur censoredcreampiesquirtinginstinst-125inst125413inst-125
    • 2021-05-28
    52 min

    [WKD-042]Monami Takarada Uses Her Slutty Techniques To Please Men By Giving Them Boob Jobs With Her Huge Tits

  • takarada monami censoredbig titsblowjobWKDwaap entertainmentk westwWKD-042WKD0422wkd00042
    • 2021-06-05
    118 min

    [VEC-479]Perverted Delinquents On A Train - Married Woman Accidentally Gets On The Train Car Reserved For The Infamous Gang Of Youth Delinquents - Ka Ayano Fuji

  • ayano kato censoredcreampiemature womanVECvenussarumegami venusVEC-479VEC479vec00479
    • 2021-06-11
    118 min

    [MIDE-938]Runaway Libido: Letting My Instincts Run Wild With A Lovely Slender Female Employee: Climaxing Repeatedly During Our 2-night And 3-day Trip - Mia Nanasawa

  • nanasawa mia censoredblowjobbeautiful girlMIDEmoodyzdragon nishikawamoodyz divaMIDE-938MIDE938mide00938
    • 2021-06-15
    135 min

    [MSFH-065]Heavenly Ejaculation Between Two Soft And Round H-Cup Titties! Sex Parlor Exclusively For Titty Fucking Fuwari Hino

  • hino fluffy censoredbig titssingle workMSFHsod createeightms sodMSFH-065MSFH0651msfh00065
    • 2021-07-01
    78 min

    200GANA-2507 Seriously Nampa, first shot. 1656 Ask JD who picked up in Shibuya to shoot a slightly mature image video! I was dazzled by the rewards, and when I left myself to the flow … I was completely naked! Slender and small! I feel the cute

  • amateur censoredsquirtingamateurganagana-2507gana2507200gana-2507
    • 2021-07-03
    111 min

    FC2PPV 1899207 Only now 1000pt off! [No individual shooting, miracle appearance beauty, beach 〇 wave very similar] Finally with Eimi-chan, a god beauty that can only be seen here! I want to feel good too! Cum on herself and cum swallowing at the woma

  • amateur uncensoredfc2
    • 2021-08-07
    127 min

    [HOKS-101]Housewife and Whore, The Fallen Housewife In Her Fourties

  • chinatsu asamiya asano censoredmature womandramaHOKSfa pro platinumogurokku kinzoufa proHOKS-101HOKS101hoks00101
    • 2021-09-03
    116 min

    [ATID-476]The Female Detective Who Surrenders To A Big Black Penis, Ren Usui

  • usui ren censoredsingle workATIDattackershaga eitarouin madATID-476ATID476atid00476
    • 2021-09-04
    49 min

    H0930 ki210904 Kana Takanashi 32years old

  • amateur uncensoredh0930
    • 2021-09-19
    51 min

    [091921_01][VR] 囁く般若ギャル

  • amateur uncensored10musume
    • 2021-10-22
    116 min

    [SSIS-216]She"ll Open Her Legs Whenever I Tell Her To. J Cups Freeuse Pussy Lover. Mei Washio

  • mei washio censoredbig titssingle workSSISs1 no 1 stylehasami kukaSSIS-216SSIS216ssis00216
    • 2021-10-26
    120 min

    [SAN-023]A Cuckold Wife Who Became Absorbed By The Strong Body And Cock Of Mikawaya - Sakura Tsuji

  • sakura tsuji censoredcreampiedeepthroatSANmazakisakura kabinmother mazaSAN-023SAN023h-796san00023
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-04
    66 min

    C0930 ki211104 Yuri Ueshima 41years old

  • amateur uncensoredc0930
    • 2021-11-06
    108 min

    [EKDV-670]Sarina Momonaga. Hot Maid In A Thong That Loves Nipple Play Gets A Role Reversal For Hot Pounding! My Submissive Maid Loves Me Excessively, It"s Truly The Good Life.

  • sarina momonaga censoredcreampiebig titsEKDVcrystal eizoue kissEKDV-670EKDV670ekdv00670
    • 2021-11-06
    134 min

    [AVSA-183]SUPER FISHEYE FETISHISM Powerful and Sexy Images of Slutty Body of Female Teacher Reiko Kobayakawa

  • kobayakawa reiko censoredbig titsmature womanAVSAavsbuddha davscollectorsAVSA-183AVSA183avsa00183
    • 2021-11-13
    136 min

    [GVH-317]Double Anal Bitches 9 June Lovejoy Ayaka Mochizuki

  • june lovejoy ayaka mochizuki censoredanalGVHglory questtorindoru tanakaGVH-317GVH317gvh00317
    • 2021-11-20
    240 min

    [OKAX-797]Pussy Sopping Wet With Lewd Juices! Anal Twitching Masturbation

  • hikaru minazuki nimo censoredOKAXk m produceokazuOKAX-797OKAX797okax00797



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored